PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00234.1.g00410.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 272aa    MW: 28729.4 Da    PI: 10.2183
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00234.1.g00410.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.9e-2086140256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Zpz_sc00234.1.g00410.1.am.mk  86 RKKLRLSKDQAAVLEECFKTHHTLTPKQKAALANSLGLRPRQVEVWFQNRRARTK 140
                                   788899***********************************************98 PP

2HD-ZIP_I/II1247.2e-4086175191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL 
  Zpz_sc00234.1.g00410.1.am.mk  86 RKKLRLSKDQAAVLEECFKTHHTLTPKQKAALANSLGLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRWCERLAEENRRLG 166
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   ke +eLr +l
  Zpz_sc00234.1.g00410.1.am.mk 167 KELAELR-AL 175
                                   ******9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.71482142IPR001356Homeobox domain
SuperFamilySSF466892.38E-1884150IPR009057Homeodomain-like
SMARTSM003892.6E-1784146IPR001356Homeobox domain
PfamPF000462.4E-1786140IPR001356Homeobox domain
CDDcd000867.95E-1786143No hitNo description
Gene3DG3DSA:1.10.10.607.9E-1986140IPR009057Homeodomain-like
PRINTSPR000311.1E-5113122IPR000047Helix-turn-helix motif
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5122138IPR000047Helix-turn-helix motif
PfamPF021837.4E-10142175IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.7E-19142185IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MPLIKTMVPQ SLDLGLSLGL GPAASQPASF RNYSGNNAVA VPDHQEERTR CSPAGSPVSS  60
GSGKRAAEIR SAGSSGDEDD VDGAARKKLR LSKDQAAVLE ECFKTHHTLT PKQKAALANS  120
LGLRPRQVEV WFQNRRARTK LKQTEVDCEH LKRWCERLAE ENRRLGKELA ELRALNAASP  180
PAPPLTTLSM CLSCRRVASS SSTSSPSNAT TDVLAAHPHG HAAANTAGNG ITSPAAAAMP  240
GHRQFFCGFR EAGPSATYAA SSGLAKAVKA AR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9681201e-114EU968120.1 Zea mays clone 314746 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964495.11e-94PREDICTED: homeobox-leucine zipper protein HOX28-like
SwissprotA2Y9311e-67HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE51e-67HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLK3XYS42e-94K3XYS4_SETIT; Uncharacterized protein
STRINGSi007082m4e-94(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-47homeobox from Arabidopsis thaliana